GTC
HOME HELP FEEDBACK SUBSCRIPTIONS ARCHIVE ADVANCED SEARCH TABLE OF CONTENTS
 QUICK SEARCH:   [advanced]


     


Genes to Cells (2005) 10, 973-987. doi:10.1111/j.1365-2443.2005.00895.x
© 2005 Blackwell Publishing or its licensors

This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Kaneko, T.
Right arrow Articles by Kaibuchi, K.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Kaneko, T.
Right arrow Articles by Kaibuchi, K.

Rho mediates endocytosis of epidermal growth factor receptor through phosphorylation of endophilin A1 by Rho-kinase

Takako Kaneko1, Akio Maeda1,2, Mikito Takefuji1, Hiroki Aoyama1, Masanori Nakayama1, Saeko Kawabata1, Yoji Kawano1, Akihiro Iwamatsu3, Mutsuki Amano1 and Kozo Kaibuchi1,*

1 Department of Cell Pharmacology, Nagoya University, Graduate School of Medicine, 65 Tsurumai, Showaku, Nagoya, Aichi, 466-8550, Japan
2 Undergraduate Program for Bioinformatics and Systems Biology, Graduate School of Information Science and Technology, University of Tokyo, 7-3-1 Hongo, Bunkyo-ku, Tokyo, 113-0033, Japan
3 Central Laboratories for Key Technology, Kirin Brewery Co. Ltd, 1-13-5 Fukuura, Kanazawaku, Yokohama, Kanagawa, 236-0004, Japan


    Abstract
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
After binding of epidermal growth factor (EGF), the EGF receptor is activated, internalized by endocytosis, and subsequently degraded in the lysosomal pathway. Endocytotic trafficking of the activated EGF receptor is essential for controlling EGF signaling. Upon ligand-induced activation of EGF receptors, Cbl (ubiquitin ligase) binds to the activated receptor and leads to translocation of the CIN85 (Cbl-interacting protein of 85 kDa)/endophilin complex in the vicinity of the activated EGF receptors. Endophilin is known as a key regulator of clathrin-mediated endocytosis, and the translocation of endophilin in the vicinity of active EGF receptor is thought to promote receptor internalization. The constitutively active mutant of small GTPase Rho inhibits EGF receptor endocytosis. In this study, we found that this inhibitory effect was canceled by the dominant negative form of Rho-associated kinase (Rho-kinase), which is an effector of Rho. To clarify the molecular mechanisms of endocytosis downstream of Rho/Rho-kinase signal, we searched for and identified endophilin A1 as a novel substrate of Rho-kinase. We identified the phosphorylation site of endophilin A1 at Thr-14 and made endophilin T14D (substitution of Thr-14 by Asp), which is expected to mimic the phosphorylation state of endophilin A1. Endophilin T14D inhibited EGF receptor internalization. Furthermore, phosphorylation of endophilin by Rho-kinase inhibited the binding to CIN85. Taken together, these results suggest that Rho-kinase phosphorylates endophilin downstream of Rho and regulates EGF receptor endocytosis through the inhibition of binding between endophilin and CIN85.


    Introduction
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
Growth factor receptors control a wide variety of biological processes, including cell proliferation, differentiation, survival, and migration (Dikic 2003). Ligand-dependent internalization of tyrosine kinase receptors is a critical step for modulating their activation. Following ligand binding, epidermal growth factor (EGF) receptor, which is one of the tyrosine kinase receptor, is rapidly internalized from the cell surface via several pathways, including clathrin-mediated endocytosis (Dikic 2003). Internalized receptors are initially delivered to early endosomes, which in turn mature into late endosomes and multivesicular bodies (Dikic 2003). In these structures, EGF receptors undergo sorting, and are either recycled back to the plasma membranes or directed to the lysosomes for degradation (Dikic 2003). Several reports suggest that ligand-dependent internalization may be a principal process regulating the duration and propagation of signal initiated by tyrosine kinase receptors, thereby preventing overstimulation that could potentially lead to cellular transformation (Dikic & Giordano 2003). Normal endocytotic trafficking of activated EGF receptor is necessary to achieve full EGF receptor tyrosine phosphorylation and activation of EGF signals (Vieira et al. 1996). Endocytotic trafficking of activated EGF receptor plays a critical role not only in attenuating EGF receptor signaling but also in establishing and controlling specific signaling pathways. Endocytosis of EGF receptors requires multiple signals, including intrinsic tyrosine kinase activity, endocytotic sequence motifs located in the cytoplasmic domain of the receptor, receptor ubiquitination as well as numerous signals in endosomes that direct receptors for lysosomal degradation (Dikic 2003). Ligand-induced ubiquitination of receptors has been linked to their internalization and endocytosis.

Cbl is a multiple-adaptor protein involved in ligand-induced down-regulation of receptor tyrosine kinases. Cbl-mediated ubiquitination of active receptors appears to be essential for receptor degradation and cessation of receptor-induced signal transduction (Joazeiro et al. 1999; Levkowitz et al. 1999; Di Fiore & De Camilli 2001; Thien & Langdon 2001; Waterman & Yarden 2001; Soubeyran et al. 2002). In addition, Cbl regulates EGF receptor endocytosis in a different fashion: Cbl recruits CIN85 (Cbl-interacting protein of 85 kDa) and endophilin (regulatory components of clathrin-mediated endocytosis) to form a complex with activated EGF receptors, thereby controlling receptor internalization (Soubeyran et al. 2002). Endophilin is the regulatory component of clathrin-coated pits (Ringstad et al. 1997; Schmidt et al. 1999; Simpson et al. 1999; Gad et al. 2000), and it can bind to lipid bilayers and induce local changes in membrane curvature (Schmidt et al. 1999). In addition, endophilin associates with other accessory protein such as dynamin, synaptojanin, and amphiphysin, participating in the formation of clathrin-coated vesicle (de Heuvel et al. 1997; Micheva et al. 1997; Ringstad et al. 1997).

The small GTPase Rho regulates various cellular functions, including endocytosis (Etienne-Manneville & Hall 2002; Symons & Rusk 2003). Rho cycles between two conformational states, the GDP-bound (inactive) state and the GTP-bound (active) state (Etienne-Manneville & Hall 2002). Rho is a molecular switch that uses a simple biochemical strategy to control the complex cellular processes of cell migration (Raftopoulou & Hall 2004) and neuronal development (Govek et al. 2005). Rho exerts its biological functions through interaction with specific effectors (Van Aelst & D'Souza-Schorey 1997). We previously identified Rho-associated kinase (Rho-kinase)/ROK{alpha}/ROCK II as an effector of Rho (Leung et al. 1995; Ishizaki et al. 1996; Matsui et al. 1996). Rho-kinase is activated by the GTP-bound active form of Rho (Ishizaki et al. 1996; Matsui et al. 1996; Amano et al. 1997). Rho-kinase appears to regulate various cellular responses downstream of Rho (Kaibuchi et al. 1999; Riento & Ridley 2003). Rho regulates transferrin and EGF receptor internalization (Lamaze et al. 1996), and it is involved in the internalization of low-density lipoprotein (LDL) receptor, which requires the clathrin-mediated endocytosis (Hrboticky et al. 2002). Thus, Rho appears to play a critical role in clathrin-mediated receptor endocytosis. However, little is known about how Rho regulates EGF receptor endocytosis.

In the present study, we found that the Rho/Rho-kinase signal regulates EGF receptor endocytosis. We identified endophilin A1 as a novel substrate of Rho-kinase. The phosphomimetic form of endophilin A1 prevented EGF receptor internalization. Furthermore, phosphorylated endophilin A1 decreased its binding activity to CIN85. Thus, Rho/Rho-kinase appears to inhibit the recruitment of endophilin A1 to the activated EGF receptor through the CIN85/Cbl complex, thereby preventing EGF receptor endocytosis.


    Results
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
Rho-kinase is involved in epidermal growth factor receptor endocytosis downstream of Rho

To examine whether Rho-kinase is involved in EGF receptor endocytosis downstream of RhoA, we measured the internalization of EGF receptors using Alexa 555-conjugated EGF in PC12D cells. When PC12D cells were incubated with Alexa 555-conjugated EGF for 60 min at 4 °C and subsequently incubated for 15 min at 37 °C, some of the labeled EGF was internalized, indicating that the EGF/EGF receptor complex was endocytosed, as previously described (Wilde et al. 1999) (Fig. 1A,B). Compared with nontransfected cells, the cells expressing EGFP did not affect the endocytosis of EGF receptors (Fig. 1A,B).



View larger version (23K):
[in this window]
[in a new window]
 
Figure 1  Rho-kinase is involved in epidermal growth factor receptor endocytosis downstream of Rho. (A) PC12D cells expressing the indicated proteins were incubated with Alexa 555-conjugated EGF for 60 min at 4 °C, then incubated for 15 min at 37 °C to allow for endocytosis, and fixed. Arrows indicate the transfected cells. Scale bar, 10 µm. (B) The EGF internalization was quantified. The percentages of the transfected cells lacking EGF endocytosis are shown. The data are means ± SD of at least three independent experiments. Asterisks indicate a statistical difference at P < 0.01.

 
The constitutively active form of Rho (RhoDA) is defective in GTPase activity and is thought to exist as the GTP-bound form in cells. The expression of RhoDA inhibited the receptor internalization (Fig. 1A,B). RB/PH (TT) (941–1388 amino acids) is composed of the Rho-binding (RB) and pleckstrin-homology (PH) domains of Rho-kinase (Matsui et al. 1996). RB/PH (TT), which has point mutations in the RB domain and does not bind to Rho, interacts with the kinase domain of Rho-kinase and thereby inhibits Rho-kinase activity without titrating out Rho in vitro (Amano et al. 1999). Thus, RB/PH (TT) functions as the dominant negative form of Rho-kinase in vivo (Amano et al. 1999). The expression of RB/PH (TT) counteracted the inhibitory effect of RhoDA (Fig. 1A,B), whereas co-expression of RB/PH (TT) and control EGFP did not affect EGF receptor endocytosis (data not shown). When cells were treated with Rho-kinase inhibitor (Y-27632) (Uehata et al. 1997) instead of RB/PH (TT), the inhibitory effect of RhoDA was canceled (data not shown). These results suggest that Rho-kinase mediates the EGF receptor internalization downstream of Rho.

Identification of endophilin A1 as a novel substrate of Rho-kinase in bovine brain

To clarify the molecular mechanisms of how the Rho/Rho-kinase signal regulates EGF receptor endocytosis, we sought to identify the responsible substrates of Rho-kinase. To search for the substrates, we separated bovine brain membrane and peripheral membrane proteins by Mono Q column chromatography, and the fractions were subjected to phosphorylation assay using the constitutively active form of Rho-kinase (GST-Rho-kinase CAT), which contains the catalytic domain (6–553 amino acids) of Rho-kinase (Amano et al. 1996, 1997) (Fig. 2A). Among the several proteins detected in this assay, one with a mass of about 40 kDa (p40) was recognized as a major band phosphorylated in a GST-Rho-kinase CAT-dependent manner (Fig. 2B, fractions 14–16). p40 was further purified by S-sepharose column chromatography (Fig. 2A,C), and the molecular identity of p40 was determined by mass spectral analysis. The molecular weight of nine peptide fragments derived from p40 coincided with those from human endophilin A1: KDLREIQHHLK, KLEGRRLDFDYK, KVDVTSRAVMEIMTK, KQNFIDPLQNLHDK, KTIEYLQPNPASRAK, KGPGYPQAEALLAEAMLK, KGGPGYPQAEALLAEAMLK, KFGRELGDDCNFGPALGEVGEAMRELSEVK, and KFGRELGDDCNFGPALGEVGEAMRELSEVK. Furthermore, p40 was recognized by anti-endophilin antibody (Fig. 2D). Thus, we conclude that p40 is endophilin A1. To examine whether Rho-kinase directly phosphorylates endophilin A1, endophilin A1 was produced as a GST-fusion protein and subjected to the phosphorylation assay. GST-endophilin A1 was phosphorylated by GST-Rho-kinase CAT (Fig. 2E). These results indicate that Rho-kinase directly phosphorylates endophilin A1 in vitro.



View larger version (24K):
[in this window]
[in a new window]
 
Figure 2  Identification of endophilin A1 as a novel substrate of Rho-kinase. (A) Purification of novel substrate of Rho-kinase from the bovine brain membrane and peripheral membrane fraction. Bovine brain gray matter was homogenized and fractionated with centrifugation. The proteins contained in the precipitate (Ppt 1) were extracted with NaCl and centrifuged. The proteins contained in the precipitate (Ppt 2) were subsequently solubilized with CHAPS and the solubilized proteins were recovered by centrifugation as the supernatant (Sup 3). Sup 3 was diluted and subjected to Mono Q column chromatography. Proteins were eluted with a linear gradient of NaCl. The eluates from Mono Q column were phosphorylated with GST-Rho-kinase CAT. The fractions containing phosphorylated proteins were collected and further fractionated by S-sepharose column chromatography with a stepwise gradient of NaCl. The eluates from S-sepharose were phosphorylated with GST-Rho-kinase CAT. (B) Phosphorylation of p40 of MonoQ eluate with GST-Rho-kinase. Bovine brain membrane and peripheral membrane fraction was loaded onto the Mono Q column. Proteins were eluted with a linear gradient of NaCl (0.0–0.5 M). Each fraction was subjected to the phosphorylation assay with or without GST-Rho-kinase CAT in the presence of [{gamma}-32P]ATP. The phosphorylated proteins were imaged by autoradiography. Fraction 15 contained a Rho-kinase substrate, p40, denoted by an arrow. (C) Phosphorylation of p40 with Rho-kinase CAT. Fraction 15 of the Mono Q column was subjected to S-sepharose column chromatography and eluted with a stepwise gradient of NaCl. The eluates from S-sepharose were phosphorylated with or without GST-Rho-kinase CAT in the presence of [{gamma}-32P]ATP. The phosphorylated proteins were imaged by autoradiography. The arrow denotes p40. (D) Immunoblot analysis with anti-endophilin antibody. Samples of each step of purification were subjected to immunoblot analysis using anti-endophilin Ab. This Ab recognized endophilin isoforms A1, A2, and A3. The arrow indicates that the band corresponding to p40 was recognized with anti-endophilin antibody. The upper band may indicate another isoform of endophilin. (E) Phosphorylation of recombinant endophilin A1 with Rho-kinase. GST-endophilin A1 was subjected to phosphorylation assay with or without GST-Rho-kinase CAT in the presence of [{gamma}-32P]ATP. The image was analyzed by autoradiography. GST-endophilin A1 was phosphorylated stoichiometrically with Rho-kinase. The arrow denotes GST-endophilin A1.

 
Endophilins regulate clathrin-coated vesicle formation (Ringstad et al. 1997, 1999; Schmidt et al. 1999; Simpson et al. 1999; Gad et al. 2000). Endophilin has been implicated in several stages of clathrin-mediated endocytosis, from generating membrane curvature, an early step, to later events such as vesicle fission and uncoating (Ringstad et al. 1999; Gad et al. 2000; Slepnev & De Camilli 2000; Huttner & Schmidt 2002). Endophilin displays lysophosphatidic acid acyltransferase activity at its N-terminus region (Schmidt et al. 1999). Its C-terminal Src-homology-3 (SH3) domain selectively interacts with other endocytotic proteins, such as amphiphysin, dynamin, and synaptojanin (de Heuvel et al. 1997; Micheva et al. 1997; Ringstad et al. 1997). Endophilin may recruit these proteins to the sites where they function during endocytosis (Reutens & Begley 2002). Endophilins A1, A2, A3, and B are a family of proteins (Sparks et al. 1996; de Heuvel et al. 1997; Giachino et al. 1997; Ringstad et al. 1997; Torrey et al. 1998). Endophilin A1 appears to be expressed mainly in the brain; endophilin A2 is ubiquitously distributed throughout many tissue types; and endophilin A3 is most abundant in testis, but is also detected at lower levels in brain and liver (Ringstad et al. 1997). Anti-endophilin antibody recognized double bands (Fig. 2D); since the anti-endophilin antibody recognized not only endophilin A1 but also A2 and A3, the upper band may be endophilin A2.

Identification of phosphorylation site of endophilin A1 by Rho-kinase

To determine the phosphorylated region of endophilin A1 by Rho-kinase, five fragments of endophilin A1 were produced as GST-fusion proteins (Fig. 3A). The purified GST-endophilin A1 1–352 amino acids, 35–352 amino acids, 1–290 amino acids, 126–290 amino acids, and 291–352 amino acids were phosphorylated by GST-Rho-kinase CAT in the presence of [{gamma}-32P]ATP in vitro. GST-endophilin A1 35–352 amino acids, 126–352 amino acids, and 291–352 amino acids were not phosphorylated by Rho-kinase CAT (Fig. 3B). These results suggest that the region containing 1–34 amino acids of endophilin A1 is phosphorylated by Rho-kinase.



View larger version (44K):
[in this window]
[in a new window]
 
Figure 3  Identification of phosphorylation site of endophilin A1 by Rho-kinase. (A) Schematic representation of constructs used in this study. Numbers refer to amino acid positions. (B) Mapping of the region in endophilin phosphorylated by Rho-kinase. GST-endophilin 1–352 amino acids, 35–352 amino acids, 1–290 amino acids, 126–290 amino acids, and 291–352 amino acids were phosphorylated by Rho-kinase CAT in the presence of [{gamma}-32P]ATP. The phosphorylated proteins were imaged by the autoradiography. (C) R/KXXS/T or R/KXS/T is known as the phosphorylation consensus sequence of Rho-kinase. Two putative consensus sequences (underline) are involved in 34 amino acids of endophilin A1. The red color shows the putative phosphorylation sites of endophilin A1 by Rho-kinase. (D) Identification of the phosphorylation site of endophilin A1 by Rho-kinase. GST-endophilin WT, T14D, T18D, and T14D/S18D were phosphorylated by Rho-kinase CAT in the presence of [{gamma}-32P]ATP. The phosphorylated proteins were imaged by autoradiography. (E) To confirm the phosphorylation site of endophilin A1 by Rho-kinase, GST-endophilin WT, T14D, and T14A were phosphorylated by Rho-kinase CAT. The phosphorylated proteins were imaged by autoradiography. (F) Sequence alignment of endophilins A1, A2, A3, and B1. In spite of the high similarity among endophilins A1, A2, and A3, the surrounding amino acid sequences of Ser-14 in endophilins A2 and A3, which are putative phosphorylation sites (underlined), are different from that of Thr-14 in endophilin A1. The red color shows the putative phosphorylation sites. (G) To examine whether endophilins A2 and B1 were phosphorylated by Rho-kinase, GST-endophilins A2 and B1 were subjected to phosphorylation assay. GST-endophilin B1 was not phosphorylated by Rho-kinase CAT under this condition, whereas GST-endophilin A1 was. GST-endophilin A2 was slightly phosphorylated by Rho-kinase CAT.

 
R/KXXS/T or R/KXS/T (X is any amino acid) is known as the phosphorylation consensus sequences of Rho-kinase (Amano et al. 1996; Matsui et al. 1996; Goto et al. 1998; Fukata et al. 1999; Kawano et al. 1999,). Rho-kinase seems to require basic amino acids, such as Arg or Lys, close to its phosphorylation site. In 34 amino acids of endophilin A1, the sequences around Thr-14 (KAT14) and Ser-18 (KVS18) are regarded as the phosphorylation consensus sequences of Rho-kinase. Thus, Thr-14 and Ser-18 are putative phosphorylation sites of Rho-kinase (Fig. 3C). To determine the phosphorylation site of endophilin A1 by Rho-kinase, we produced endophilin A1 mutants (endophilin T14D, S18D, and T14D/S18D), in which Thr-14 and/or Ser-18 were replaced by Asp. The GST-fused endophilin A1 mutants were subjected to the phosphorylation assay. GST-endophilin T14D and T14D/S18D were not phosphorylated by Rho-kinase CAT, whereas GST-endophilin S18D was phosphorylated (Fig. 3D). To confirm the phosphorylation site of endophilin A1 by Rho-kinase, we also produced endophilin mutant (endophilin T14A) in which Thr-14 was replaced by Ala. GST-endophilin T14A was not phosphorylated by Rho-kinase CAT (Fig. 3E). Taken together, these results indicate that Thr-14 is the major site of endophilin A1 phosphorylation by Rho-kinase in vitro.

Endophilins A1, A2, and A3 share a sequence similarity in the amino terminus region (Fig. 3F). The sequences around Ser-14 (KAS14) in the amino terminus region of endophilins A2 and A3 were regarded as phosphorylation consensus sequences of Rho-kinase (KXS) (Fig. 3F). It was thus expected that Rho-kinase would phosphorylate Ser-14 of endophilin A2 and A3. To examine whether Rho-kinase phosphorylates endophilin isoforms, GST-endophilins A2 and B were subjected to the phosphorylation assay. Endophilin A2 was slightly phosphorylated by Rho-kinase CAT (Fig. 3G), whereas endophilin B was not (Fig. 3G). Because surrounding amino acid sequences of Ser-14 in endophilin A2 are almost identical to those of Ser-14 in endophilin A3, endophilin A3 may be hardly phosphorylated by Rho-kinase. Thus, endophilin A1 may be the best substrate of Rho-kinase among the endophilin isoforms.

Production and characterization of site- and phosphorylation-state-specific antibody for endophilin A1 at Thr-14

To investigate how the phosphorylation of endophilin A1 by Rho-kinase is regulated in vivo, we prepared the site- and phosphorylation-state-specific antibody for endophilin A1. We prepared rabbit polyclonal antibody (anti-pT14 Ab), raised against the synthetic phosphopeptide GCQFHKA-phosphoT-QKVSEK. The specificity of anti-pT14 Ab was examined by immunoblot analysis. Equal amounts of GST-endophilin A1 with various ratios between phosphorylated and non-phosphorylated forms were loaded on the gel. GST-endophilin A1 phosphorylated by Rho-kinase CAT in vitro was specifically detected by anti-pT14 Ab in a dose-dependent manner (Fig. 4). These results indicate that anti-pT14 Ab specifically recognizes endophilin A1 phosphorylated at Thr-14 by Rho-kinase.



View larger version (30K):
[in this window]
[in a new window]
 
Figure 4  Specificity of phosphorylation-site-specific antibody. A total of 1 pmol of GST-endophilin A1 containing the indicated amounts of GST-endophilin A1 phosphorylated by GST-Rho-kinase CAT was resolved by SDS-PAGE followed by immunoblotting with anti-pT14 Ab (upper panel) and anti-endophilin Ab (lower panel).

 
Rho-kinase-dependent phosphorylation of endophilin A1 at Thr-14 in vivo

We examined whether Rho-kinase can phosphorylate endophilin A1 at Thr-14 in vivo. EGFP-endophilin A1 was expressed exogenously with wild-type (WT), dominant negative (RB/PH (TT)), and constitutively active (Rho-kinase CAT) forms of Rho-kinase in COS7 cells. An equivalent amount of EGF-endophilin A1 WT and T14D was expressed in each case (Fig. 5A, lower). The expression of Rho-kinase CAT induced the phosphorylation of endophilin A1, whereas RB/PH (TT) did not. Rho-kinase WT slightly induced the phosphorylation of endophilin A1 (Fig. 5A, upper). EGFP-endophilin T14D co-expressed with Rho-kinase CAT was not recognized by anti-pT14 Ab (Fig. 5A, upper). These results indicate that endophilin A1 is phosphorylated at Thr-14 by Rho-kinase in COS7 cells.



View larger version (45K):
[in this window]
[in a new window]
 
Figure 5  Phosphorylation of endophilin A1 by Rho-kinase in vivo. (A) EGFP-endophilin A1 WT or EGFP-endophilin A1 T14D was transfected together with the indicated myc-tagged Rho-kinase mutants in COS7 cells. The cell lysates were resolved by SDS-PAGE and analyzed by immunoblot analysis with anti-pT14 Ab (upper panel) or anti-EGFP Ab (lower panel). (B) PC12D cells were stimulated with 0.1 µM Calyclin A (phosphatase inhibitor) and 10 µM or 30 µM Y-27632 (Rho-kinase inhibitor). The cell lysates were resolved by SDS-PAGE and immunoblotted with anti-pT14 Ab, anti-endophilin Ab, anti-MBS pT855 Ab, or anti-MBS Ab.

 
Next we examined whether endogenous endophilin A1 was phosphorylated at Thr-14 via Rho-kinase in vivo. We also monitored the phosphorylation level of myosin-binding subunit of myosin phosphatase (MBS), which is phosphorylated by Rho-kinase at Thr-850, as a positive control. When total cell lysate of non-stimulated PC12D cells was immunoblotted with anti-pT14 Ab, endophilin A1 phosphorylated at Thr-14 was not detected. Calyclin A (phosphatase inhibitor) induced the phosphorylation of endophilin A1 at Thr-14. Y-27632 (Uehata et al. 1997), which is a Rho-kinase specific inhibitor, inhibited calyclin A-induced phosphorylation of endophilin A1 (Fig. 5B). These results indicate that endophilin A1 is phosphorylated at Thr-14 by Rho-kinase in vivo. In non-stimulated cell lysate, the phosphorylation of MBS was detected by anti-MBS pT855 Ab (anti-phospho-MYPT-1; Upstate, Waltharn, MA, USA) (Fig. 5B). Y-27632 inhibited the basal level and calyclin A-induced phosphorylation of MBS at Thr-855 (Fig. 5B). Thus, under these conditions, Y-27632 effectively inhibits the activity of Rho-kinase. These results suggest that Rho-kinase phosphorylates endogenous endophilin A1 at Thr-14 in vivo.

Rho-kinase is involved in epidermal growth factor receptor internalization through phosphorylation of endophilin A1

To examine whether Rho-kinase regulates the EGF receptor endocytosis through the phosphorylation of endophilin A1, we measured the internalization of EGF receptors using Alexa 555-conjugated EGF. The expression of control EGFP did not affect the internalization of EGF receptor (Fig. 6A,B). The expression of endophilin T14D (substitution of Thr-14 by Asp), which was expected to mimic phosphorylated endophilin A1 (Kamisoyama et al. 1994; Sweeney et al. 1994; Bresnick et al. 1995), inhibited the internalization of EGF receptor, whereas endophilin WT and T14A (substitution of Thr-14 by Ala) did not affect the internalization (Fig. 6A,B). Although the mode of action of endophilin T14D is not well understood, endophilin T14D may substitute for endogenous endophilin A1 to interact with its binding partner, thereby inactivating the complex and inhibiting functions of endogenous endophilin A1.



View larger version (24K):
[in this window]
[in a new window]
 
Figure 6  Rho-kinase is involved in epidermal growth factor receptor endocytosis through phosphorylation of endophilin A1. (A) PC12D cells expressing the indicated proteins were incubated with Alexa 555-conjugated EGF for 60 min at 4 °C, then incubated for 15 min at 37 °C to allow for endocytosis, and fixed. Arrows indicate the transfected cells. Scale bar, 10 µm. (B) The EGF internalization was quantified. The percentages of transfected cells lacking EGF endocytosis are shown. The data are means ± SD of at least three independent experiments. Asterisks indicate a statistical difference from the value of EGFP-expressing cells at P < 0.01.

 
Endophilin A1 phosphorylated by Rho-kinase has decreased binding activity to CIN85

Recently, it has been reported that endophilin binds to CIN85 and regulates EGF receptor endocytosis through the endophilin/CIN85/Cbl complex (Soubeyran et al. 2002). We examined whether phosphorylation of endophilin A1 affects its binding activity to CIN85. Purified GST-endophilin A1 was phosphorylated by Rho-kinase CAT in the presence or absence of ATP. Phosphorylated or non-phosphorylated endophilin A1 were immobilized on glutathione-sepharose beads and incubated with porcine brain lysate. CIN85 interacted with non-phosphorylated GST-endophilin A1, whereas CIN85 less effectively interacted with the phosphorylated GST-endophilin A1 (Fig. 7). These results indicate that endophilin A1 phosphorylated by Rho-kinase is prevented from interacting with CIN85.



View larger version (42K):
[in this window]
[in a new window]
 
Figure 7  Effects of phosphorylated endophilin A1 by Rho-kinase on the ability of interaction with CIN85. GST-endophilin A1 was phosphorylated by constitutively active Rho-kinase (GST-Rho-kinase CAT) in the presence (+) or absence (–) of ATP. Phosphorylated or non-phosphorylated endophilin A1 immobilized on glutathione-sepharose beads was incubated with extracts of porcine brain for 60 min at 4 °C. GST-endophilin A1 and the bound proteins were analyzed by immunoblot.

 

    Discussion
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
Role of Rho/Rho-kinase in endocytosis

Several groups have shown that RhoA regulates clathrin-mediated endocytosis (Lamaze et al. 1996; Hrboticky et al. 2002). Lamaze et al. (1996) reported that RhoA modulates transferrin and EGF receptor endocytosis; RhoA is also involved in the internalization of LDL receptor, which requires clathrin-mediated endocytosis (Hrboticky et al. 2002). However, the modes of action of Rho in endocytosis have not yet been elucidated.

In the present study, we found that Rho-kinase was involved in the endocytosis of EGF receptor downstream of Rho. We identified endophilin A1 as a substrate of Rho-kinase. Endophilin is a key regulator of clathrin-mediated endocytosis (Ringstad et al. 1997; Schmidt et al. 1999; Simpson et al. 1999; Gad et al. 2000). Endophilin binds to the regulatory components of clathrin-mediated endocytosis, amphiphysin, dynamin, and synaptojanin via the SH3 domain of the C-terminus (de Heuvel et al. 1997; Micheva et al. 1997; Ringstad et al. 1997). Endophilin is involved in membrane bending at the onset of budding during the early stage of endocytosis (Scales & Scheller 1999; Schmidt et al. 1999; Hill et al. 2001; Guichet et al. 2002; Verstreken et al. 2002; Schuske et al. 2003). Other reports suggest a role of endophilin during later stages of endocytosis (Ringstad et al. 1999) during vesicle uncoating (Gad et al. 2000; Fabian-Fine et al. 2003; Schuske et al. 2003) and in the progression of vesicles through the synaptic vesicle cycle (Fabian-Fine et al. 2003). In addition, endophilin appears to be required for stabilizing synaptojanin in synaptic termini and in the recruitment of synaptojanin to endocytotic pits (Schuske et al. 2003; Verstreken et al. 2003). Thus, endophilin participates in multiple stages of clathrin-mediated endocytosis, from early membrane invagination to clathrin-coated vesicle uncoating.

We identified Thr-14 as the phosphorylation site of endophilin A1 by Rho-kinase. We also found that the phospho-mimetic form of endophilin A1 inhibited EGF receptor endocytosis. Taken together, these results suggest that Rho modulates EGF receptor endocytosis through the phosphorylation of endophilin A1 by Rho-kinase.

It may be noted that the phosphorylation of endophilin A1 was not detected in cell lysate without the treatment of phosphatase inhibitor (Calyclin A). Calyclin A-induced phosphorylation of endophilin A1 was strongly inhibited by Y-27632, suggesting that Rho-kinase phosphorylates endophilin A1 in vivo, but this phosphorylation is tightly regulated by phosphatase and rapidly turned over. Rho-kinase phosphorylates MBS, which leads to the inactivation of myosin phosphatase (Kimura et al. 1996). Rho-kinase and myosin phosphatase cooperatively regulate the phosphorylation state of the substrates including myosin light chain (MLC), adducin, and the ezrin/radixin/moesin (ERM) family proteins (Kaibuchi et al. 1999). It is possible that Rho-kinase regulates the phosphorylation of endophilin A1 through the dual regulation, which is the direct phosphorylation by Rho-kinase and inactivation of phosphatase. Thus, it is likely that the spatiotemporal phosphorylation of endophilin A1 occurs near the plasma membranes and plays a critical role in the internalization of EGF receptor.

Molecular mechanisms of EGF receptor endocytosis by Rho/Rho-kinase

Activated EGF receptors are removed from the cell surface via endocytosis and subsequent degradation in the lysosome (Dikic 2003). Ligand-dependent internalization may be a principal process regulating the duration and propagation of signal initiated by tyrosine kinase receptor, thereby preventing overstimulation.

Upon ligand stimulation, the Cbl/CIN85/endophilin complex was shown to promote EGF receptor internalization (Soubeyran et al. 2002). Cbl, which is an ubiquitin ligase, induces the receptor internalization via a pathway that is functionally separable from its ubiquitin ligase activity and is dependent on interactions with adaptor protein CIN85 (Dikic 2003). Several groups independently identified CIN85 (Take et al. 2000) as Ruk (regulator of ubiquitous kinase) (Gout et al. 2000), SETA (SH3 domain-containing gene expressed in tumorigenic astrocytes) (Borinstein et al. 2000), and SH3KBP1 (SH3-domain kinase-binding protein 1) (Narita et al. 2001). CIN85 interacts with two members of the Cbl family, Cbl and Cbl-b, but not Cbl-3 (Szymkiewicz et al. 2002). Binding of CIN85 to Cbl is mediated via its SH3 domains and is enhanced by EGF-induced tyrosine phosphorylation of Cbl, whereas the proline-rich region of CIN85 constitutively interacts with endophilin (Soubeyran et al. 2002). CIN85 appears to rapidly recruit endophilin to activated receptor complex, thus controlling receptor internalization (Petrelli et al. 2002; Soubeyran et al. 2002). Inhibition of the Cbl/CIN85/endophilin interaction is sufficient to block EGF receptor endocytosis and degradation, without perturbing the ability of Cbl to ubiquitinate activated receptors (Soubeyran et al. 2002). This mechanism seems to be common among certain receptor tyrosine kinases; for instance, it has been reported that the Cbl/CIN85/endophilin pathway is involved in the endocytosis of hepatocyte growth factor, platelet-derived growth factor (PDGF), and c-Kit (Petrelli et al. 2002; Szymkiewicz et al. 2002). Thus, endophilin has begun to emerge as a key regulator of receptor tyrosine kinases, and plays a pivotal role in receptor endocytosis.

Here we found that the phosphorylation of endophilin A1 by Rho-kinase inhibited the interaction with CIN85. Thus, endophilin A1 phosphorylated by Rho-kinase may not be recruited to endocytotic sites, resulting in inhibition of EGF-receptor endocytosis (Fig. 8). The present study shows for the first time that the Rho/Rho-kinase signaling pathway mediates EGF receptor endocytosis and reveals the underlying mechanisms.



View larger version (20K):
[in this window]
[in a new window]
 
Figure 8  Schematic model for the role of endophilin A1 phosphorylated by Rho/Rho-kinase. In resting cells, CIN85 and endophilin are constitutively associated and are not bound to Cbl or EGF receptors (Soubeyran et al. 2002). Ligand-induced activation of EGF receptors induces translocation of the endophilin/CIN85 complex in the vicinity of active EGF receptors, whereby endophilin regulates clathrin-mediated endocytosis. Rho-kinase phosphorylates endophilin A1 and inhibits binding between endophilin A1 and CIN85. Thus, activation of the Rho/Rho-kinase signal prevents EGF receptor endocytosis, because endophilin cannot be recruited to the vicinity of active EGF receptors. EGF stimulation elevates the activation of p190RhoGAP, which is known as a GTPase-activating protein (GAP) for Rho. Following EGF stimulation, Rho is inactivated.

 
Relationship between epidermal growth factor signal and receptor endocytosis

EGF stimulation activates p190RhoGAP, which is known as GTPase-activating protein (GAP) for Rho (Burridge & Wennerberg 2004). The activated p190RhoGAP induces GTP hydrolysis of GTP-bound Rho and inactivation of Rho (Burridge & Wennerberg 2004). Following EGF stimulation, both EGF receptor endocytosis and inactivation of Rho are induced rapidly. These observations are reasonable because activated Rho inhibits EGF receptor endocytosis. Thus, to progress the receptor endocytosis, EGF signals may induce the spatiotemporal inactivation of Rho and Rho-kinase. mDia interacting protein (DIP) binds to p190RhoGAP and inactivates Rho following EGF stimulation (Meng et al. 2004). When the expression levels of DIP are suppressed by RNAi, the EGF-induced cell migration is inhibited (Meng et al. 2004). Thus, the inactivation of Rho/Rho-kinase signal upon EGF stimulation may play an important role in the regulation of EGF-receptor endocytosis and cell motility.

EGF receptor endocytosis and trafficking are important for controlling the signaling pathways and cellular responses to EGF. EGF-induced activation of mitogen-activated protein kinase is dependent upon receptor endocytosis (Vieira et al. 1996). Inhibition of Cbl/CIN85/endophilin complex formation was sufficient to block EGF internalization, delay receptor degradation, and enhance EGF-induced gene expression (Soubeyran et al. 2002). It has been reported that only cell surface EGF receptors effectively participate in phospholipase D function (Haugh et al. 1999). A subset of signal transducers requires the normal endocytotic trafficking of EGF receptor for full activation of EGF signals. Thus, endocytotic trafficking of activated EGF receptor plays a critical role not only in attenuating EGF receptor signaling but also in establishing and controlling specific signaling pathways.

Brain-derived growth factor and PDGF induce down-modification of the EGF receptor by increasing the internalization of cell surface receptors (Huang et al. 1988). Elevated intracellular Ca2+ and phorbol esters are thought to inhibit EGF internalization by a mechanism involving activation of protein kinase C (Logsdon & Williams 1984). Several signaling pathways that modify EGF action are mediated through the internalization of EGF receptors. Here we indicate that Rho/Rho-kinase is involved in the EGF receptor internalization. Thus, the Rho/Rho-kinase signal may modulate the EGF signaling through EGF receptor endocytosis downstream of certain extracellular signals.

This study sheds light on the molecular mechanisms underlying EGF receptor endocytosis. We found that Rho regulates EGF receptor endocytosis through the phosphorylation of endophilin A1 by Rho-kinase. Rho/Rho-kinase may regulate EGF signal activity through receptor endocytosis. Understanding how this process is regulated in living cells will be a challenge for further investigations.


    Experimental procedures
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
Materials and chemicals

Anti-endophilin antibody was kindly provided by Dr P. De Camilli (Yale University, New Haven, CT, USA) (Fig. 1D). We also prepared anti-endophilin antibody, which was raised against GST-endophilin A1 (Figs 4 and 5). A rabbit polyclonal antibody against endophilin A1 phosphorylated at Thr-14 was produced against phosphopeptide Gly-Cys-Gln9-Phe-His-Lys-Ala-phosphoThr14-Gln-Lys-Val-Ser-Glu-Lys20 by Biologica Co. (Aichi, Japan). The antisera were then affinity purified against the respective phosphopeptides. cDNA-encoding mouse endophilin A1 was provided by Dr H. D. Söling (Max-Planck Institute, Göttingen, Germany). pCAGGS vector was provided by Dr M. Nakafuku (Children's Medical Research Foundation, Cincinnati). All materials used in the nucleic acid study were purchased from Takara Shuzo Co. (Kyoto, Japan). Other materials and chemicals were obtained from commercial sources.

Plasmid constructs

cDNA fragments encoding endophilin A1 1–352 amino acids (full length), 35–352 amino acids, 1–290 amino acids, 126–290 amino acids, and 291–352 amino acids were amplified by polymerase chain reaction (PCR) using the obtained clone as a template, containing the entire open reading frame of mouse endophilin A1. The endophilin mutants, T14D and T14A, were generated with a site-detected mutagenesis kit (Stratagene, La Jolla, CA, USA) by changing Thr-14 into Asp-14 or Ala-14. cDNAs encoding endophilins A2 and B were cloned from a human fetal library. The cDNA fragments were subcloned into pGEX-4T-1 (Amersham Pharmacia Biotech, Buckinghamshire, UK), pCAGGS-myc, and pEGFP-C1 (Clontech Laboratories, Inc., Palo Alto, CA) vectors.

Phosphorylation assay

The phosphorylation assay of the samples was performed as previously described (Amano et al. 1996). In brief, the kinase reaction for Rho-kinase was carried out in 50 µL of a reaction mixture (50 mM Tris/HCl at pH 7.5, 2 mM EDTA, 1 mM DTT, 7 mM MgCl2, 10 µM[{gamma}-32P]ATP [1–20 GBq/mmol], and purified GST [glutathione-S-transferase]-constitutively active form of Rho-kinase [GST-Rho-kinase CAT]) for 10–60 min at 30 °C. GST-Rho-kinase CAT was produced in Sf9 cells with a baculovirus system (Matsuura et al. 1987) and purified on glutathione-sepharose 4B beads (Amersham Pharmacia Biotech, Buckinghamshire, UK) (Matsui et al. 1996). Then the reaction mixtures were boiled in SDS sample buffer and subjected to SDS-PAGE. The radiolabelled bands were visualized by an image analyzer (BAS 2000; Fuji, Tokyo, Japan).

Purification of a Rho-kinase substrate, p40

Bovine brain gray matter was homogenized and fractionated with centrifugation at 20 000 g. The proteins contained in the precipitate (Ppt 1) were extracted with 2 M NaCl and centrifuged at 10 000 g. The proteins contained in the precipitate (Ppt 2) were subsequently solubilized with 1% 3-[(3-cholamidopropyl) dimethylammonio] propanesulfonic acid (CHAPS) and the solubilized proteins were recovered by centrifugation at 100 000 g in the supernatant (Sup 3). Sup 3 was diluted to 0.5% CHAPS and subjected to Mono Q column chromatography. Proteins were eluted with a linear gradient of NaCl (0.0–0.5 M). The eluates from Mono Q column were phosphorylated with GST-Rho-kinase CAT. The fractions containing phosphorylated proteins were collected and further fractionated by S-sepharose column chromatography with a step-wise gradient of NaCl (0.0–0.5 M). The eluates from S-sepharose were phosphorylated with GST-Rho-kinase CAT.

Mass spectral analysis

The fractions containing p40 were separated by SDS-PAGE and transferred onto a polyvinylidene difluoride membrane (Problot, Applied Biosystems, Foster, CA). The immobilized protein was reduced, S-carboxymethylated, and digested in situ with Achromobacter protease I (a Lys-C) (Iwamatsu 1992). Molecular mass analyses of Lys-C fragments were performed by matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry using a PerSeptive Biosystem Voyager-DE/RP (Foster, CA, USA) (Jensen et al. 1996). We identified protein by comparing the molecular weight determined by v/MS and theoretical peptide masses from the proteins registered in NCBInr.

Culture preparation

PC12D cells were grown in Dulbecco's modified eagle medium (DMEM) containing 10% fetal bovine serum (FBS) and 5% horse serum at 37 °C in an air with 5% CO2 atmosphere at constant humidity. COS7 cells were cultured in DMEM containing 10% FBS. For transfection experiments, LipofectAMINE 2000 and LipofectAMINE reagents (Invitrogen, Carlsbad, CA, USA) were used.

Pull-down assay

Purified GST-tagged endophilin A1 (GST-endophilin A1) was phosphorylated by GST-Rho-kinase CAT in the presence or absence of ATP. Phosphorylated or non-phosphorylated endophilin A1 was immobilized onto glutathione-sepharose 4B beads for 60 min at 4 °C. The GST-endophilin A1 immobilized beads were incubated with porcine brain lysate for 60 min at 4 °C. After removal of the supernatant, the beads were washed three times with buffer (20 mM Tris/HCl at pH 7.5, 1 mM EDTA, 1 mM DTT, 50 mM NaCl, 10 µg/mL leupeptin, 10 µM APMSF, 0.1% NP-40, 0.1 µM Calyclin A, 25 mM NaF, 2 mM Na-orthovanadate, 10 mMß-glycerophosphate). Then the samples were boiled in SDS sample buffer and subjected to SDS-PAGE and immunoblot analysis with the indicated antibodies.

Internalization assay

Internalization assay with EGF receptor in PC12D cells was performed 24 h after transfection. The cells were washed three times in cold PBS and incubated with 0.5 µg/mL Alexa Fluor 555-conjugated EGF (Molecular Probes, Eugene, OR) in DMEM containing 2 mg/mL BSA and HEPES for 60 min at 4 °C. After the incubation with Alexa Fluor 555-EGF at 4 °C, the cells were transferred to 37 °C for 15 min and incubated with 0.2 M acetic acid (pH 2.5) containing 0.5 M NaCl for 5 min on ice, to remove surface-bound ligand, and washed with cold PBS. The cells were fixed with 3.7% formaldehyde in PBS buffer for 10 min at room temperature, rinsed three times with PBS, and mounted. The cells were observed using a Zeiss Axiophoto microscope (Carl Zeiss, Oberkochen, Germany), and the percentage of the transfected cells displaying significantly reduced levels of endocytosis were counted. Fluorescent images were taken with a confocal laser microscopy system (LSM510; Carl Zeiss).


    Acknowledgements
 
We thank Dr P. De Camilli (Yale University) for kindly providing anti-endophilin antibody and Dr H. D. Söling (Max-Planck Institute, Göttingen) for providing the mouse cDNA of endophilin A1. pCAGGS vector was provided by Dr M. Nakafuku (Children's Medical Research Foundation, Cincinnati). We thank T. Ishii for secretarial assistance. This research was supported in part by Grants-in-Aid for Scientific Research, Grant-in-Aid for Creative Scientific Research, and The 21st Century Center of Excellence (COE) Program from the Ministry of Education, Culture, Sports, Science and Technology of Japan, Special coordination funds for promoting Science and Technology, and the National Institute of Biomedical Innovation.


    Footnotes
 
Communicated by: Noriko Osumi

* Correspondence: E-mail: kaibuchi{at}med.nagoya-u.ac.jp


    References
 Top
 Abstract
 Introduction
 Results
 Discussion
 Experimental procedures
 References
 
Amano, M., Ito, M., Kimura, K., et al. (1996) Phosphorylation and activation of myosin by Rho-associated kinase (Rho-kinase). J. Biol. Chem. 271, 20246–20249.[Abstract/Free Full Text]

Amano, M., Chihara, K., Kimura, K., et al. (1997) Formation of actin stress fibers and focal adhesions enhanced by Rho-kinase. Science 275, 1308–1311.[Abstract/Free Full Text]

Amano, M., Chihara, K., Nakamura, N., et al. (1999) The COOH terminus of Rho-kinase negatively regulates rho-kinase activity. J. Biol. Chem. 274, 32418–32424.[Abstract/Free Full Text]

Borinstein, S.C., Hyatt, M.A., Sykes, V.W., et al. (2000) SETA is a multifunctional adapter protein with three SH3 domains that binds Grb2, Cbl, and the novel SB1 proteins. Cell Signal 12, 769–779.[CrossRef][Medline]

Bresnick, A.R., Wolff-Long, V.L., Baumann, O. & Pollard, T.D. (1995) Phosphorylation on threonine-18 of the regulatory light chain dissociates the ATPase and motor properties of smooth muscle myosin II. Biochemistry 34, 12576–12583.[CrossRef][Medline]

Burridge, K. & Wennerberg, K. (2004) Rho and Rac take center stage. Cell 116, 167–179.[CrossRef][Medline]

Di Fiore, P.P. & De Camilli, P. (2001) Endocytosis and signaling: an inseparable partnership. Cell 106, 1–4.[CrossRef][Medline]

Dikic, I. (2003) Mechanisms controlling EGF receptor endocytosis and degradation. Biochem. Soc. Trans. 31, 1178–1181.[Medline]

Dikic, I. & Giordano, S. (2003) Negative receptor signalling. Curr. Opin. Cell Biol. 15, 128–135.[CrossRef][Medline]

Etienne-Manneville, S. & Hall, A. (2002) Rho GTPases in cell biology. Nature 420, 629–635.[CrossRef][Medline]

Fabian-Fine, R., Verstreken, P., Hiesinger, P.R., et al. (2003) Endophilin promotes a late step in endocytosis at glial invaginations in Drosophila photoreceptor terminals. J. Neurosci. 23, 10732–10744.[Abstract/Free Full Text]

Fukata, Y., Oshiro, N., Kinoshita, N., et al. (1999) Phosphorylation of adducin by Rho-kinase plays a crucial role in cell motility. J. Cell Biol. 145, 347–361.[Abstract/Free Full Text]

Gad, H., Ringstad, N., Low, P., et al. (2000) Fission and uncoating of synaptic clathrin-coated vesicles are perturbed by disruption of interactions with the SH3 domain of endophilin. Neuron 27, 301–312.[CrossRef][Medline]

Giachino, C., Lantelme, E., Lanzetti, L., Saccone, S., et al. (1997) A novel SH3-containing human gene family preferentially expressed in the central nervous system. Genomics 41, 427–434.[CrossRef][Medline]

Goto, H., Kosako, H., Tanabe, K., et al. (1998) Phosphorylation of vimentin by Rho-associated kinase at a unique amino-terminal site that is specifically phosphorylated during cytokinesis. J. Biol. Chem. 273, 11728–11736.[Abstract/Free Full Text]

Gout, I., Middleton, G., Adu, J., et al. (2000) Negative regulation of PI 3-kinase by Ruk, a novel adaptor protein. EMBO J. 19, 4015–4025.[CrossRef][Medline]

Govek, E.E., Newey, S.E. & Van Aelst, L. (2005) The role of the Rho GTPases in neuronal development. Genes Dev. 19, 1–49.[Abstract/Free Full Text]

Guichet, A., Wucherpfennig, T., Dudu, V., et al. (2002) Essential role of endophilin A in synaptic vesicle budding at the Drosophila neuromuscular junction. EMBO J. 21, 1661–1672.[CrossRef][Medline]

Haugh, J.M., Schooler, K., Wells, A., Wiley, H.S. & Lauffenburger, D.A. (1999) Effect of epidermal growth factor receptor internalization on regulation of the phospholipase C-gamma1 signaling pathway. J. Biol. Chem. 274, 8958–8965.[Abstract/Free Full Text]

de Heuvel, E., Bell, A.W., Ramjaun, A.R., et al. (1997) Identification of the major synaptojanin-binding proteins in brain. J. Biol. Chem. 272, 8710–8716.[Abstract/Free Full Text]

Hill, E., van Der Kaay, J., Downes, C.P. & Smythe, E. (2001) The role of dynamin and its binding partners in coated pit invagination and scission. J. Cell Biol. 152, 309–323.[Abstract/Free Full Text]

Hrboticky, N., Feldmeer, T., Essler, M., Wiedemann, A. & Aepfelbacher, M. (2002) Involvement of the GTPase Rho in the cellular uptake of low density lipoprotein by human skin fibroblasts. Biochem. Biophys. Acta 1580, 123–132.[Medline]

Huang, S.S., Lokeshwar, V.B. & Huang, J.S. (1988) Modulation of the epidermal growth factor receptor by brain-derived growth factor in Swiss mouse 3T3 cells. J. Cell Biochem. 36, 209–221.[CrossRef][Medline]

Huttner, W.B. & Schmidt, A.A. (2002) Membrane curvature: a case of endofeelin. Trends Cell Biol. 12, 155–158.[CrossRef][Medline]

Ishizaki, T., Maekawa, M., Fujisawa, K., et al. (1996) The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase. EMBO J. 15, 1885–1893.[Medline]

Iwamatsu, A. (1992) S-carboxymethylation of proteins transferred onto polyvinylidene difluoride membranes followed by in situ protease digestion and amino acid microsequencing. Electrophoresis 13, 142–147.[CrossRef][Medline]

Jensen, O.N., Podtelejnikov, A. & Mann, M. (1996) Delayed extraction improves specificity in database searches by matrix-assisted laser desorption/ionization peptide maps. Rapid Commun. Mass Spectrom. 10, 1371–1378.[CrossRef][Medline]

Joazeiro, C.A., Wing, S.S., Huang, H., et al. (1999) The tyrosine kinase negative regulator c-Cbl as a RING-type, E2-dependent ubiquitin-protein ligase. Science 286, 309–312.[Abstract/Free Full Text]

Kaibuchi, K., Kuroda, S. & Amano, M. (1999) Regulation of the cytoskeleton and cell adhesion by the Rho family GTPases in mammalian cells. Annu. Rev. Biochem. 68, 459–486.[CrossRef][Medline]

Kamisoyama, H., Araki, Y. & Ikebe, M. (1994) Mutagenesis of the phosphorylation site (serine 19) of smooth muscle myosin regulatory light chain and its effects on the properties of myosin. Biochemistry 33, 840–847.[CrossRef][Medline]

Kawano, Y., Fukata, Y., Oshiro, N., et al. (1999) Phosphorylation of myosin-binding subunit (MBS) of myosin phosphatase by Rho-kinase in vivo. J. Cell Biol. 147, 1023–1038.[Abstract/Free Full Text]

Kimura, K., Ito, M., Amano, M., et al. (1996) Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase). Science 273, 245–248.[Abstract]

Lamaze, C., Chuang, T.H., Terlecky, L.J., Bokoch, G.M. & Schmid, S.L. (1996) Regulation of receptor-mediated endocytosis by Rho and Rac. Nature 382, 177–179.[CrossRef][Medline]

Leung, T., Manser, E., Tan, L. & Lim, L. (1995) A novel serine/threonine kinase binding the Ras-related RhoA GTPase which translocates the kinase to peripheral membranes. J. Biol. Chem. 270, 29051–29054.[Abstract/Free Full Text]

Levkowitz, G., Waterman, H., Ettenberg, S.A., et al. (1999) Ubiquitin ligase activity and tyrosine phosphorylation underlie suppression of growth factor signaling by c-Cbl/Sli-1. Mol. Cell 4, 1029–1040.[CrossRef][Medline]

Logsdon, C.D. & Williams, J.A. (1984) Intracellular Ca2+ and phorbol esters synergistically inhibit internalization of epidermal growth factor in pancreatic acini. Biochem. J. 223, 893–900.[Medline]

Matsui, T., Amano, M., Yamamoto, T., et al. (1996) Rho-associated kinase, a novel serine/threonine kinase, as a putative target for small GTP binding protein Rho. EMBO J. 15, 2208–2216.[Medline]

Matsuura, Y., Possee, R.D., Overton, H.A. & Bishop, D.H. (1987) Baculovirus expression vectors: the requirements for high level expression of proteins, including glycoproteins. J. Gen. Virol. 68 (Pt 5), 1233–1250.[Abstract/Free Full Text]

Meng, W., Numazaki, M., Takeuchi, K., et al. (2004) DIP (mDia interacting protein) is a key molecule regulating Rho and Rac in a Src-dependent manner. EMBO J. 23, 760–771.[CrossRef][Medline]

Micheva, K.D., Ramjaun, A.R., Kay, B.K. & McPherson, P.S. (1997) SH3 domain-dependent interactions of endophilin with amphiphysin. FEBS Lett. 414, 308–312.[CrossRef][Medline]

Narita, T., Amano, F., Yoshizaki, K., et al. (2001) Assignment of SH3KBP1 to human chromosome band Xp22.1-->p21.3 by in situ hybridization. Cytogenet. Cell Genet. 93, 133–134.[CrossRef][Medline]

Petrelli, A., Gilestro, G.F., Lanzardo, S., et al. (2002) The endophilin-CIN85-Cbl complex mediates ligand-dependent downregulation of c-Met. Nature 416, 187–190.[CrossRef][Medline]

Raftopoulou, M. & Hall, A. (2004) Cell migration: Rho GTPases lead the way. Dev. Biol. 265, 23–32.[CrossRef][Medline]

Reutens, A.T. & Begley, C.G. (2002) Endophilin-1: a multifunctional protein. Int. J. Biochem. Cell Biol. 34, 1173–1177.[CrossRef][Medline]

Riento, K. & Ridley, A.J. (2003) Rocks: multifunctional kinases in cell behaviour. Nature Rev. Mol. Cell Biol. 4, 446–456.[CrossRef][Medline]

Ringstad, N., Nemoto, Y. & De Camilli, P. (1997) The SH3p4/Sh3p8/SH3p13 protein family: binding partners for synaptojanin and dynamin via a Grb2-like Src homology 3 domain. Proc. Natl. Acad. Sci. USA 94, 8569–8574.[Abstract/Free Full Text]

Ringstad, N., Gad, H., Low, P., et al. (1999) Endophilin/SH3p4 is required for the transition from early to late stages in clathrin-mediated synaptic vesicle endocytosis. Neuron 24, 143–154.[CrossRef][Medline]

Scales, S.J. & Scheller, R.H. (1999) Lipid membranes shape up. Nature 401, 123–124.[CrossRef][Medline]

Schmidt, A., Wolde, M., Thiele, C., et al. (1999) Endophilin I mediates synaptic vesicle formation by transfer of arachidonate to lysophosphatidic acid. Nature 401, 133–141.[CrossRef][Medline]

Schuske, K.R., Richmond, J.E., Matthies, D.S., et al. (2003) Endophilin is required for synaptic vesicle endocytosis by localizing synaptojanin. Neuron 40, 749–762.[CrossRef][Medline]

Simpson, F., Hussain, N.K., Qualmann, B., et al. (1999) SH3-domain-containing proteins function at distinct steps in clathrin-coated vesicle formation. Nature Cell Biol. 1, 119–124.[CrossRef][Medline]

Slepnev, V.I. & De Camilli, P. (2000) Accessory factors in clathrin-dependent synaptic vesicle endocytosis. Nature Rev. Neurosci. 1, 161–172.[Medline]

Soubeyran, P., Kowanetz, K., Szymkiewicz, I., Langdon, W.Y. & Dikic, I. (2002) Cbl-CIN85-endophilin complex mediates ligand-induced downregulation of EGF receptors. Nature 416, 183–187.[CrossRef][Medline]

Sparks, A.B., Rider, J.E., Hoffman, N.G., et al. (1996) Distinct ligand preferences of Src homology 3 domains from Src, Yes, Abl, Cortactin, p53bp2, PLCgamma, Crk, and Grb2. Proc. Natl. Acad. Sci. USA 93, 1540–1544.[Abstract/Free Full Text]

Sweeney, H.L., Yang, Z., Zhi, G., Stull, J.T. & Trybus, K.M. (1994) Charge replacement near the phosphorylatable serine of the myosin regulatory light chain mimics aspects of phosphorylation. Proc. Natl. Acad. Sci. USA 91, 1490–1494.[Abstract/Free Full Text]

Symons, M. & Rusk, N. (2003) Control of vesicular trafficking by Rho GTPases. Curr. Biol. 13, R409–R418.[CrossRef][Medline]

Szymkiewicz, I., Kowanetz, K., Soubeyran, P., et al. (2002) CIN85 participates in Cbl-b-mediated down-regulation of receptor tyrosine kinases. J. Biol. Chem. 277, 39666–39672.[Abstract/Free Full Text]

Take, H., Watanabe, S., Takeda, K., Yu, Z.X., Iwata, N. & Kajigaya, S. (2000) Cloning and characterization of a novel adaptor protein, CIN85, that interacts with c-Cbl. Biochem. Biophys. Res. Commun. 268, 321–328.[CrossRef][Medline]

Thien, C.B. & Langdon, W.Y. (2001) Cbl: many adaptations to regulate protein tyrosine kinases. Nature Rev. Mol. Cell Biol. 2, 294–307.[CrossRef][Medline]

Torrey, T., Kim, W., Morse, H.C. 3rd & Kozak, C.A. (1998) Cloning, expression and genetic mapping of the mouse SH3 domain protein, SH3D2B. Mamm. Genome 9, 74–75.[CrossRef][Medline]

Uehata, M., Ishizaki, T., Satoh, H., et al. (1997) Calcium sensitization of smooth muscle mediated by a Rho-associated protein kinase in hypertension. Nature 389, 990–994.[CrossRef][Medline]

Van Aelst, L. & D'Souza-Schorey, C. (1997) Rho GTPases and signaling networks. Genes Dev. 11, 2295–2322.[Free Full Text]

Verstreken, P., Kjaerulff, O., Lloyd, T.E., et al. (2002) Endophilin mutations block clathrin-mediated endocytosis but not neurotransmitter release. Cell 109, 101–112.[CrossRef][Medline]

Verstreken, P., Koh, T.W., Schulze, K.L., et al. (2003) Synaptojanin is recruited by endophilin to promote synaptic vesicle uncoating. Neuron 40, 733–748.[CrossRef][Medline]

Vieira, A.V., Lamaze, C. & Schmid, S.L. (1996) Control of EGF receptor signaling by clathrin-mediated endocytosis. Science 274, 2086–2089.[Abstract/Free Full Text]

Waterman, H. & Yarden, Y. (2001) Molecular mechanisms underlying endocytosis and sorting of ErbB receptor tyrosine kinases. FEBS Lett. 490, 142–152.[CrossRef][Medline]

Wilde, A., Beattie, E.C., Lem, L., et al. (1999) EGF receptor signaling stimulates SRC kinase phosphorylation of clathrin, influencing clathrin redistribution and EGF uptake. Cell 96, 677–687.[CrossRef][Medline]

Received: 29 April 2005
Accepted: 5 July 2005





This Article
Right arrow Abstract Freely available
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Right arrow Citation Map
Services
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Citing Articles
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow